Putative udp-rhamnose:rhamnosyltransferase 1

Author: vked

August undefined, 2024

Tīmeklis2004. gada 11. okt. · Putative UDP-rhamnose:rhamnosyltransferase 1. Gene. GT4. Status. UniProtKB reviewed (Swiss-Prot) Organism. Fragaria ananassa (Strawberry) (Fragaria chiloensis x Fragaria virginiana) Amino acids. 478. Protein existence. … Tīmeklisspecific rhamnosyltransferase activity from pummelo leaves transferred rhamnose from UDP-Rha to the C-2 position of the glucose of prunin, forming naringin, and it also rhamno- sylated H7G to neohesperidin (7). This was the first time such a specific 1-2 rhamnosyltransferase activity was re- ported (7).

Identification and characterization of three flavonoid 3-O ...

TīmeklisThe recombinant enzyme regiospecifically transfers a rhamnose moiety to 8-prenylkaempferol (1) and anhydroicaritin (2) at the 3-OH position to form baohuoside … Tīmeklis2024. gada 1. okt. · Cloning and characterization of a putative UDP-rhamnose synthase 1 from Populus euramericana Guinier. J. Plant Biol. (2013) P. Jones et al. … firefox version 94.0.2

Biochemical characterization of rhamnosyltransferase involved in ...

TīmeklisThe uridine diphosphate glycosyltransferase (UGT) plays the central role in glycosylation of small molecules by transferring sugars to various acceptors including bioactive … Tīmeklis2024. gada 1. apr. · 2.1. The putative pathway of acteoside biosynthesis based on isotope label and chemical principle. ... via the test of their substrate(s) and product(s). In this way, their synthesis roles will be determined. For example, UDP-rhamnose:rhamnosyltransferase from Lobelia erinus was involved in the 3-o … TīmeklisWe cloned rhamnosyltransferase genes (RTs) from AB and confirmed their UDP-rhamnose-dependent rhamnosyltransferase activities on Dp3G using recombinant … firefox version 89

Putative udp-rhamnose:rhamnosyltransferase 1

Tīmeklis2013. gada 1. febr. · Quercitrin production of 3522 mg/L was achieved in the recombinant strain by coupling the UDP-rhamnose generation system with A. … Tīmeklisthat Asp356, His357, Pro147 and Ile148 are key residues for sugar donor recognition and speciﬁcity for UDP-b-L-rhamnose. The mutant H357Q exhibited activity with both UDP-b-L-rhamnose and UDP-glucose. Struc-tural comparison and mutagenesis conﬁrmed that His21 is a key residue as the catalytic base and the only

Did you know?

Tīmeklis2024. gada 2. sept. · Maximal UDP-rhamnose production reached 82.2 mg/L in the recombinant strain by introducing the cellobiose phosphorolysis pathway and … Tīmeklis2024. gada 15. nov. · A candidate UDP-rhamnose synthase cDNA with hypothesized annotation as probable rhamnose biosynthetic enzyme was also picked and …

Tīmeklis2024. gada 17. janv. · The recombinant enzyme regiospecifically transfers a rhamnose moiety to 8-prenylkaempferol (1) and anhydroicaritin (2) at the 3-OH position to form baohuoside II (1a) and baohuoside I (2a) in vitro. In addition, a UDP-rhamnose synthase gene, EpRhS, from E. pseudowushanense was functionally characterized … TīmeklisThis HePS is characterized by a different ratio in monomeric composition (glucose, galactose, and rhamnose in a molar ratio of 1:0.3:0.2), ... a putative …

Tīmeklis2024. gada 12. dec. · Rhamnosyltransferase (RT) and rhamnose synthase (Rhs) are the key enzymes that are responsible for the biosynthesis of rhamnosides and UDP-l-rhamnose (UDP-Rha) in plants, respectively. Tīmeklis2016. gada 30. jūn. · Three full-length putative UDP-rhamnose: flavonoid glycoside 2″-O-beta-l-rhamnosyltransferase-like genes were isolated and designated as LcFGRT2, LcFGRT4, and LcFGRT5. Phylogenetic analysis showed that these genes were clustered with other glucoside-glycosyltransferases. Notable activities in catalyzing …

TīmeklisTarget Alias Description ECC score Gene Family Method Actions; LOC_Os07g10220.1: No alias: Putative UDP-rhamnose:rhamnosyltransferase 1 OS=Fragaria... 0.03: Archaeplastida

Tīmeklis2014. gada 28. jūl. · UDP-galactose: 5.1 ± 0.9: UDP-rhamnose: ND: UDP-xylose: ND: UDP-arabinose ... Oosumi T, Matsuura Y, Yokoyama R, Whittier RF, Komeda Y. The Arabidopsis ERECTA gene encodes a putative receptor protein kinase with ... Yonekura-Sakakibara K, Tohge T, Niida R, Saito K. Identification of a flavonol 7–O … firefox version 97TīmeklisThis HePS is characterized by a different ratio in monomeric composition (glucose, galactose, and rhamnose in a molar ratio of 1:0.3:0.2), ... a putative rhamnosyltransferase gene and the putative UDP-galactose lipid carrier transferase gene, are located. These parts of both gene clusters have the highest homology (up … firefox versionen windows 10Tīmeklis2024. gada 1. okt. · Cloning and characterization of a putative UDP-rhamnose synthase 1 from Populus euramericana Guinier. J. Plant Biol. (2013) P. Jones et al. ... (2003) M. Bar-Peled et al. Juvenile-specific localization and accumulation of a rhamnosyltransferase and its bitter flavonoid in foliage, flowers, and young citrus … firefox version history release historyTīmeklisThe recombinant enzyme regiospecifically transfers a rhamnose moiety to 8-prenylkaempferol (1) and anhydroicaritin (2) at the 3-OH position to form baohuoside II (1a) and baohuoside I (2a) in vitro. In addition, a UDP-rhamnose synthase gene, EpRhS , from E. pseudowushanense was functionally characterized and used to … firefox version 9 free downloadTīmeklis2024. gada 1. aug. · Gene FvH4_1g12660, located in the Fvb1 interval and annotated as a putative UDP-rhamnose: rhamnosyltransferase 1 was identified as the most likely candidate for the gene controlling ellagic acid ... firefox versionen downloadTīmeklisgenome browser: aa seq: 469 aa aa seq db search makmaknlhvmilpwsafghlipffqlsialakagvsvsfvstpnnirrlpkipqnletl iklveiplptlesqslpigaeatvdlpsdkidhlkiaydllqyplkqyvmdqqldwiiid firefox version 95 downloadTīmeklisLOC18435939 putative UDP-rhamnose:rhamnosyltransferase 1 [] Gene ID: 18435939, updated on 26-Mar-2024. Summary Other designations. LOW QUALITY … firefox version release history